PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542804.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 723aa    MW: 78945.1 Da    PI: 6.4725
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542804.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.1e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E+ ++++a +++G   W +I +++g ++t+ q++s+ qk+
   XP_010542804.1 24 RERWTEDEHSRFLEALRLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.56E-161874IPR009057Homeodomain-like
PROSITE profilePS5129418.9891973IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-72170IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-172271IPR006447Myb domain, plants
SMARTSM007171.0E-112371IPR001005SANT/Myb domain
PfamPF002491.7E-122467IPR001005SANT/Myb domain
CDDcd001671.47E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MEKNISGEEL VTKIRKPYTI TKQRERWTED EHSRFLEALR LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAQAKG IPICQALDIE IPPPRPKRKP SNPYPRKTGN GESTSQVSSA  120
KVVKLDSSAS FSHCNQALDL EKKPFTEKPN GVEKVPNGNG NQDDNCSGVS ARPTEAHCSS  180
ISSVNKYPFP NKAAPRNPSS FRESEPDLTK ATADNGTSKT SNADNSCYSQ DNDANVLPHI  240
SISKEDNGVN GLSPVGNMNG IQSYPWHFPV HVLNGNVGTY PQNPPGMGFQ DFMFRPVGEV  300
HGHSGLFTIP STSATSQHQD NVPRSSRQAF PAFHPAFVPA CHTQDDYRSF LQISSTFSNL  360
IMSALLQNPA AHAAATFAAS FWPYGNVGSS NDSSTSTTIQ TDGAFPPRQM SSPPPSMAAI  420
TAATVAAATA WWAAHGLLPI CAPFTCLPMS APIVPPSVSA QTELPETDKK DAATANPQQP  480
AMEQGEAQVL ASPFESDDDL DENGRTEQDT GLKTEDHKEK VVEVQEQVQD SNTTQKKKQV  540
DRSSCGSNTP SGSDVETDAL EKAAEKDKEE DVKETDGNQT GTESSTRRTS RSKDNSSDSW  600
KEVSEEGRMA FDALFARERL PQSFSLALDV EKESPEKGKG NREEREREMA HKSKIQDSCS  660
KETASRSEGN GGITIGIGEG KSLRARRTGF KPYKRCSMEA KESSSQAEEK VSKRIRLDSK  720
AST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542804.10.0PREDICTED: protein LHY-like isoform X3
SwissprotQ6R0H10.0LHY_ARATH; Protein LHY
TrEMBLA0A061DT310.0A0A061DT31_THECC; Homeodomain-like superfamily protein isoform 1
STRINGAT1G01060.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-150MYB_related family protein